General Information

  • ID:  hor002404
  • Uniprot ID:  O18845
  • Protein name:  Motilin
  • Gene name:  MLN
  • Organism:  Ovis aries (Sheep)
  • Family:  Motilin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FVPIFTYGEVQRMQEKERYKGQ
  • Length:  22
  • Propeptide:  MLSRKATAILLVVHAAAMLASQTEGFVPIFTYGEVQRMQEKERYKGQKKSLSVQQRSEEVGPVDPAEPREEKQEVIKLTAPVEIGMRMNSRQLEKYQATLEGLLRKALPSSRNAQ
  • Signal peptide:  MLSRKATAILLVVHAAAMLASQTEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  MLNR
  • Target Unid:  W5PF20
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O18845-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002404_AF2.pdbhor002404_ESM.pdb

Physical Information

Mass: 310886 Formula: C124H189N33O35S
Absent amino acids: ACDHLNSW Common amino acids: EQ
pI: 9.12 Basic residues: 4
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -105 Boman Index: -5765
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 44.09
Instability Index: 905.45 Extinction Coefficient cystines: 2980
Absorbance 280nm: 141.9

Literature

  • PubMed ID:  9427564
  • Title:  Isolation and Sequencing of the cDNA Encoding the Motilin Precursor From Sheep Intestine